This is a working overview of SR9009, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-02-28 and is reviewed periodically as new material appears.
SR9009 is a synthetic small molecule developed as an agonist of the nuclear receptors REV-ERBα (NR1D1) and REV-ERBβ (NR1D2). These receptors help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, SR9009 alters transcription of genes involved in lipid metabolism, inflammation, and mitochondrial function. It is not an approved medicine, and its pharmacological profile in humans remains largely uncharacterized. The compound is frequently discussed in the context of circadian biology and metabolic research rather than clinical use.
Preclinical reports have linked SR9009 to improved endurance and altered energy expenditure in rodents. Such findings have prompted interest in whether REV-ERB activation can influence skeletal muscle metabolism. However, the reported effects depend on dose, route, and experimental model, and replication across laboratories is limited. Human trials have not established comparable outcomes, so claims about exercise performance remain speculative. The absence of controlled human data is a central limitation in interpreting these observations.
Analytical chemists detect SR9009 with liquid chromatography-tandem mass spectrometry, commonly abbreviated LC-MS/MS. Sample preparation may involve protein precipitation, liquid-liquid extraction, or solid-phase extraction before analysis. Laboratories can target the parent compound or its metabolites, depending on the matrix and the purpose of testing. Anti-doping methods require sensitive and specific assays because concentrations in biological samples can be low. Reference standards and validated methods are essential for reliable identification and quantification.
Regulatory agencies have not approved SR9009 for human therapeutic use. It is typically sold as a research chemical with labels stating that it is not for human consumption. The World Anti-Doping Agency prohibits the substance in sport, generally under the category of non-approved substances. Customs and national laws may restrict importation, sale, or possession. Product quality and legal status can vary by country and vendor, and therapeutic claims are not permitted in regulated advertising because the compound lacks approval.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic REV-ERB agonist | Small molecule; not a steroid or peptide. |
| Primary targets | NR1D1 and NR1D2 | Also known as REV-ERBα and REV-ERBβ. |
| Studied routes | Intraperitoneal in rodents | Oral bioavailability in humans is not established. |
| Human approval | No approved therapeutic indication | No recognized clinical use. |
| Key uncertainty | Human physiological effects | Preclinical findings may not translate. |
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not a steroid, peptide, or natural hormone. In scientific literature, it appears under the code SR9009 and in non-scientific contexts as Stenabolic. The compound was identified through chemical screening efforts aimed at targeting circadian clock components. Its status remains investigational, and no regulatory agency has approved it as a human medicine.
REV-ERB proteins help regulate daily cycles in gene expression, including genes tied to lipid and glucose metabolism. SR9009 binds these receptors and alters their activity in cell and animal experiments. Consequences observed in rodents include changes in skeletal muscle oxidative capacity, blood lipid levels, and exercise performance. The precise chain from receptor occupancy to whole-body effects is still an active area of study. Human responses cannot be assumed from rodent data.
Minister for Economic Growth Nicola Willis proposes scrapping several procurement rules including the Living Wage requirement for government contracts. She also proposes a new economic benefits test for both government services and building contracts. The Whanganui District Council scraps its food scraps collection service in response to local opposition. 13 March – The New Zealand Government hosts a two-day Infrastructure Investment Summit in Auckland with the goal of attracting international investment from foreign sovereign funds and multinational companies. Protesters from various groups including ActionStation picket the summit's premises at Park Hyatt. 14 March: Compass Group confirms it will acquire the assets of the bankrupt Libelle Group food catering service. State Highway 1 Desert Road reopens after two months of repairs. 17 March: The Whangārei District Council rescinds its decision in November 2024 to defy a Government directive to fluoridate its water supply, pending a High Court injunction on the matter expected to be released on 18 March. A 14-year-old youth is convicted of the manslaughter of Dunedin teenager Enere McLaren-Taana in May 2024. 19 March – The blobfish (Psychrolutes microporos) is named the 2025 New Zealand Fish of the Year. 20 March – The 2025 New Zealander of the Year Awards are announced, with women's health academic Bev Lawton named New Zealander of the Year. 21 March: Wellington High Court Justice Jason McHerron dismisses a judicial review against Cuba Street's rainbow crossing.
Free nerve ending A type of unencapsulated nerve ending that detects pain, temperature, and crude touch. These are the most common type of cutaneous receptors. Frontal lobe A region of the cerebral cortex involved in decision-making, planning, motor function, problem-solving, and aspects of personality. Located at the front of each cerebral hemisphere. Frontal eye fields A region in the frontal lobe involved in voluntary eye movements and visual attention. It plays a role in saccadic control and visual tracking. Functional connectivity A measure of how different brain regions interact during rest or tasks, often assessed using fMRI or EEG by examining correlations in activity over time. Functional magnetic resonance imaging (fMRI) A neuroimaging technique that measures brain activity by detecting changes in blood oxygenation (BOLD signal). It is used to study brain function in real time. Fusiform gyrus A brain region located in the temporal and occipital lobes involved in high-level visual processing, including facial recognition and object categorization. Fusiform face area (FFA) A specialized part of the fusiform gyrus that responds selectively to faces. It is often studied in the context of prosopagnosia (face blindness) and visual expertise.
xv. ISBN 978-1-62683-043-1. Retrieved March 22, 2021. Siddiqi, Asif A. (2000). Challenge to Apollo: the Soviet Union and the space race, 1945–1974 (PDF). Washington, D.C.: National Aeronautics and Space Administration, NASA History Div. Retrieved February 10, 2026. Siddiqi, Asif A. (2003). Sputnik and the Soviet Space Challenge. Gainesville: University Press of Florida. ISBN 0-8130-2627-X. Siddiqi, Asif A. (2003). The Soviet Space Race with Apollo. Gainesville: University Press of Florida. ISBN 0-8130-2628-8. Stocker, Jeremy (2004). Britain and Ballistic Missile Defence, 1942–2002. London: Frank Case. pp. 12–24. ISBN 0-7146-5696-8. Swenson, Loyd S. Jr.; Grimwood, James M.; Alexander, Charles C. (1966). This New Ocean: A History of Project Mercury. NASA. ISBN 1-934941-87-5. Retrieved January 8, 2023. Turnhill, Reginald (2004). The Moonlandings: An Eyewitness Account. New York: Cambridge University Press. ISBN 0-521-81595-9. Pervushin, Anton (2011). 108 minutes which changed the world (in Russian). Эксмо. ISBN 978-5-699-48001-2.
Sources: en.wikipedia.org
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Best Practices for Hit Finding == For educational purposes the European Federation for Medicinal Chemistry and Chemical Biology (EFMC) shared a series of webinars including 'Best Practices for Hit Finding' as well as 'Hit Generation Case Studies'.
=== Scintigraphy/radionuclide imaging === Scintigraphy can be used to measure the extent and distribution of the amyloid throughout the body, including the liver, kidney, spleen, and heart. A radiolabelled serum amyloid P component can be administered to a patient intravenously and the P component pools to the amyloid deposit proportional to the size of the deposit. The labeling of the P component can then be pictured by a gamma camera. Technetium radionuclide scans can now reliably diagnosis cardiac amyloidosis, with certain scanning methods having greater than 99% sensitivity (but only 91% specific for amyloidosis). In this method of imaging, radiolabeled technetium is injected into the body where it binds to cardiac amyloid deposits. A subsequent scan is taken to determine where the tracer stays, therefore highlighting the amyloid deposition in the heart. This method allows for a noninvasive definitive diagnosis of cardiac amyloidosis (as in the past an endomyocardial biopsy was required)
Sources: en.wikipedia.org
It is a synthetic compound that acts as an agonist at REV-ERBα and REV-ERBβ. It is used mainly as a research chemical to study circadian and metabolic pathways. It is not approved for human therapeutic use.
REV-ERB receptors generally repress transcription when bound by natural heme. SR9009 is described as an agonist that enhances this repressive activity. The result is altered expression of clock and metabolic genes.
Published controlled human trials are lacking. Some sources cite limited or unofficial reports, but these do not establish safety or efficacy. Claims about human performance effects remain unverified.
Legality depends on the country and the intended use. In many places it is not approved as a medicine and may be sold only as a research chemical. Importation or possession can be restricted, and sports organizations prohibit it.