A practical reference on anti-doping: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-04-26 and is reviewed periodically as new material appears.
Analytical identification and purity assessment often use high-performance liquid chromatography with ultraviolet detection or mass spectrometry. Liquid chromatography–tandem mass spectrometry is used to detect and quantify SR9009 in biological matrices, including urine and blood, for anti-doping or pharmacokinetic studies. Nuclear magnetic resonance spectroscopy can confirm molecular structure. Stability depends on form and storage: the solid is generally more stable than solutions, and repeated freeze–thaw cycles may degrade samples. Purity is typically reported as a percentage from a certificate of analysis.
Regulatory treatment of SR9009 varies by country and context. It is not approved as a therapeutic drug by agencies such as the United States Food and Drug Administration or the European Medicines Agency. Sports authorities list it as a prohibited substance; the World Anti-Doping Agency classifies it among hormone and metabolic modulators. Legal status for personal possession or sale differs across jurisdictions, and some countries may restrict it under analog or research chemical laws. Buyers who seek verified material often rely on independent laboratory testing because online product labels may not match contents.
Laboratory samples of SR9009 are typically handled as research chemicals rather than pharmaceuticals. Suppliers usually state that the material is for research use only and not for human or veterinary administration. Storage recommendations generally call for a freezer at approximately −20 °C, protection from light, and a desiccated environment. The solid is often described as a white to off-white powder. Solubility is commonly reported in organic solvents such as dimethyl sulfoxide and ethanol, with low solubility in water.
SR9009 is not approved as a medicine by major regulatory agencies. It is commonly sold as a research chemical, a category that may fall outside customary drug approval and quality rules. In sports, the World Anti-Doping Agency lists SR9009 as a prohibited substance. Athletes who use it can face sanctions if it is detected in a sample. Legal status varies by country, and importation may be restricted. Enforcement practices differ across borders.
Detection of SR9009 in biological samples usually employs liquid chromatography coupled with tandem mass spectrometry. This method can identify the parent compound and sometimes metabolites in urine or blood. Because exposure can be low and clearance may be rapid, sample timing and limits of detection matter. Laboratories validate assays for sensitivity and specificity. Results are interpreted alongside chain-of-custody and quality-control records. Urine is the common matrix for anti-doping analysis, while blood may be used in research settings.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Common supplier description |
| Solubility | Soluble in DMSO and ethanol | Low solubility in water |
| Typical storage | −20 °C, desiccated, dark | For research samples |
| Analytical method | LC-MS/MS | Used for detection and quantification |
| Regulatory status | Prohibited in sport | WADA metabolic modulator class |
SR9009 is a synthetic small molecule developed as an agonist of the nuclear receptors REV-ERBα (NR1D1) and REV-ERBβ (NR1D2). These receptors help regulate circadian rhythms and metabolic gene expression. In cell and animal studies, SR9009 alters transcription of genes involved in lipid metabolism, inflammation, and mitochondrial function. It is not an approved medicine, and its pharmacological profile in humans remains largely uncharacterized. The compound is frequently discussed in the context of circadian biology and metabolic research rather than clinical use.
Preclinical reports have linked SR9009 to improved endurance and altered energy expenditure in rodents. Such findings have prompted interest in whether REV-ERB activation can influence skeletal muscle metabolism. However, the reported effects depend on dose, route, and experimental model, and replication across laboratories is limited. Human trials have not established comparable outcomes, so claims about exercise performance remain speculative. The absence of controlled human data is a central limitation in interpreting these observations.
The mechanism of action involves binding to REV-ERB receptors and recruiting corepressor complexes, which represses target gene transcription. This contrasts with many nuclear receptor agonists that activate transcription. Downstream effects may include changes in autophagy, mitochondrial biogenesis, and lipid handling, but the precise pathways remain an active area of study. Whether these molecular events translate into meaningful physiological effects in humans is unresolved. Most evidence comes from cultured cells and rodent models rather than human participants.
SR9009 is a synthetic small molecule studied as an agonist of the nuclear receptors REV-ERBα and REV-ERBβ. It is not an approved medicine and has no established human therapeutic use. The compound appears in scientific literature as a tool for probing circadian and metabolic regulation. Online sellers often label it as a research chemical, sometimes using the nickname Stenabolic. Its chemical identity is distinct from selective androgen receptor modulators, stimulants, and peroxisome proliferator-activated receptor delta agonists. Researchers use it mainly in cell and animal experiments.
At the molecular level, SR9009 binds REV-ERBα and REV-ERBβ and alters their repressive activity on target genes. These nuclear receptors help regulate the circadian clock, lipid synthesis, glucose metabolism, and inflammatory pathways. By changing transcription, the compound can shift the timing or magnitude of downstream metabolic processes in model systems. It does not act through androgen receptors or adenosine receptors, which distinguishes it from several substances sold for athletic performance. Whether the same transcriptional changes occur in humans at tolerable exposures remains an open question because controlled human studies are lacking.
Regulatory treatment of SR9009 reflects its investigational status. The compound has no approved human therapeutic indication, and sports authorities prohibit its use. It appears on anti-doping lists as a non-approved substance or metabolic modulator, depending on the list version. Products sold online as research chemicals are not quality-controlled medicines, so their identity and purity can differ from the label. Such products may also contain unlisted compounds, which complicates both testing and safety assessment.
Scientific discussion of SR9009 often separates animal evidence from human anecdote. Rodent studies provide controlled data on endurance, metabolism, and gene expression, but they use specific strains, doses, and treatment durations. Human reports are mostly uncontrolled and cannot establish cause and effect. Open questions include oral bioavailability, tissue distribution, metabolic stability, and long-term effects. Review articles generally call for more rigorous pharmacokinetic and safety research before any clinical use could be considered.
For long-term storage, SR9009 is typically kept as a solid at low temperature, protected from moisture and light. Desiccated conditions limit hydrolysis, while opaque containers reduce photochemical breakdown. Solutions are less stable than solids and are often stored frozen in aliquots to avoid repeated freeze-thaw cycles. Stability data are not standardized across all suppliers, so users should rely on certificate-of-analysis information when available. Degradation may appear as color change, precipitate, or decreased chromatographic purity.
Laboratory identification of SR9009 typically relies on chromatographic separation coupled to mass spectrometry, often with ultraviolet detection as a secondary check. Nuclear magnetic resonance spectroscopy can confirm molecular structure when a reference standard is available. Because many suppliers sell the compound as a research chemical, independent identity testing is important for experimental reproducibility. A single retention time is not sufficient proof of identity, especially when related compounds may be present. Purity assessments usually report a percentage based on area normalization.
SR9009 is generally described as poorly soluble in water and more soluble in organic solvents such as dimethyl sulfoxide and ethanol. Stock solutions are commonly prepared in an organic solvent before dilution into an aqueous buffer or vehicle. Precipitation can occur if the organic fraction is reduced too quickly or if the final concentration exceeds the compound's solubility limit. Sonication or gentle warming may aid dissolution in some protocols, but excessive heat can promote degradation. Container material and pH can also influence observed solubility.
Serine hydroxymethyltransferase (SHMT) also catalyzes the biosynthesis of glycine (retro-aldol cleavage) from serine, transferring the resulting formaldehyde synthon to 5,6,7,8-tetrahydrofolate. However, that reaction is reversible, and will convert excess glycine to serine. SHMT is a pyridoxal phosphate (PLP) dependent enzyme.
=== Books === Heseltine's book Where There's A Will was written by a team of ghostwriters directed by Keith Hampson and Julian Haviland (former political editor of ITN and The Times). Academics, businessmen and economists contributed, and he often had them thresh out ideas in front of him. "He acquires by social intercourse the knowledge that other people acquire by reading", one adviser commented. The collated drafts were then rewritten by Haviland to "give it one voice". Hugo Young called it "the most impressive [book of its kind] I've read by a modern Conservative". Heseltine's second book, The Challenge of Europe: Can Britain Win?, appeared in 1989. Heseltine was in close touch with President of the European Commission Jacques Delors, who paid a 3-hour visit to his Victoria office, diplomats Nicholas Henderson and Antony Acland and economist Christopher Johnson, who is thought to have persuaded him of the merits of European monetary union. The book won a £10,000 Adolphe Bentincke prize for advancing European unity. Heseltine was a qualified supporter of the social charter (a stronger precursor to the Social Chapter from which John Major would later opt out in the Maastricht Treaty). He was seen as devoted to Europe as a matter of what he perceived as Britain's self-interest, not on an emotional level like Edward Heath, Roy Jenkins or Kenneth Clarke.
Dithiothreitol (DTT) is an organosulfur compound with the formula (CH(OH)CH2SH)2. A colorless compound, it is classified as a dithiol and a diol. DTT is redox reagent also known as Cleland's reagent, after W. Wallace Cleland. The reagent is commonly used in its racemic form. Its name derives from the four-carbon sugar, threose. DTT has an epimeric ('sister') compound, dithioerythritol (DTE).
Sources: en.wikipedia.org
== Thermodynamics == Self-assembly is an equilibrium process, i.e. the individual and assembled components exist in equilibrium. In addition, the flexibility and the lower free energy conformation is usually a result of a weaker intermolecular force between self-assembled moieties and is essentially enthalpic in nature. The thermodynamics of the self-assembly process can be represented by a simple Gibbs free energy equation:
Lepirudin is an anticoagulant that functions as a direct thrombin inhibitor. Brand name: Refludan, Generic: Lepirudin rDNA for injection. Lepirudin is a recombinant hirudin derived from yeast cells. Lepirudin is almost identical to hirudin extracted from Hirudo medicinalis, having the amino acid sequence LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ with disulfide bridges at Cys6-Cys14, Cys16-Cys28 and Cys22-Cys39, and differs from by the substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. Lepirudin may be used as an anticoagulant when heparins (unfractionated or low-molecular-weight) are contraindicated because of heparin-induced thrombocytopenia.
In August 1967, brothers Michael and Peter Giles, drummer and singer/bassist respectively, and professional musicians in working bands since their mid-teens in Dorset, England, advertised for a "singing organist" to join a new group they were forming. Fellow Dorset musician Robert Fripp – a guitarist who neither sang or played organ – responded, and Giles, Giles and Fripp was born. The trio signed to Deram Records and recorded one album, The Cheerful Insanity of Giles, Giles and Fripp, released in 1968. They hovered on the edge of success, but were never able to make a commercial breakthrough. Attempting to expand their sound, the three recruited Ian McDonald on keyboards and woodwinds. McDonald brought along two other participants: his then-girlfriend, former Fairport Convention singer Judy Dyble, whose brief tenure with the group ended when the two split, and lyricist, roadie, and art strategist Peter Sinfield, with whom he had been writing songs – a partnership initiated when McDonald had said to Sinfield (regarding his band Creation), "Peter, I have to tell you that your band is hopeless, but you write some great words. Would you like to get together on a couple of songs?" Fripp, meanwhile, saw Clouds at the Marquee Club in London, which spurred him to incorporate classical-inspired melodies into his writing and utilise improvisation to find new ideas. No longer interested in Peter Giles's more whimsical pop songs, Fripp recommended that his old friend, fellow guitarist and singer Greg Lake, could join to replace either Peter or Fripp himself.
Sources: en.wikipedia.org
=== Amateur === The North Carolina Tigers compete as an Australian rules football club in the United States Australian Football League, in the Eastern Australian Football League. The Raleigh Cú Chulainn Gaelic Athletic Association competes in men's and women's Gaelic Football, Hurling, and Camogie. It is a member in the Southeast Division of the United States Gaelic Athletic Association and the Gaelic Athletic Association based in Ireland. The Raleigh GAA won the Junior B Men's Football national championship in 2014. The Raleigh GAA and the North Carolina Tigers Australian rules football clubs compete in the annual Oak City Cup where both clubs compete under the compromise football rules adapted by Ireland and Australia for international competition. Raleigh is also home to one of the Cheer Extreme All Stars gyms. In 2009 and again in 2010, Cheer Extreme Raleigh's Small Senior Level 5 Team were silver medalists at the Cheerleading Worlds Competition in Orlando, Florida, and in 2012 they received the bronze medal. Raleigh is also home to one of the Southeast's premier Hardcourt Bike Polo clubs. Because of the area's many billiards rooms, Raleigh is home to one of the largest amateur league franchises for playing pool, the Raleigh, Durham, Chapel Hill American Poolplayers Association. There are leagues available in formats for players of any skill level.
==== MeSH D06.472.759 – placental hormones ==== MeSH D06.472.759.367 – chorionic gonadotropin MeSH D06.472.759.367.125 – chorionic gonadotropin, beta subunit, human MeSH D06.472.759.367.562 – glycoprotein hormones, alpha subunit MeSH D06.472.759.451 – gonadotropins, equine MeSH D06.472.759.692 – placental lactogen
Modern drug discovery is thus usually a capital-intensive process that involves large investments by pharmaceutical industry corporations as well as national governments (who provide grants and loan guarantees). Despite advances in technology and understanding of biological systems, drug discovery is still a lengthy, "expensive, difficult, and inefficient process" with low rate of new therapeutic discovery. In 2010, the research and development cost of each new molecular entity was about US$1.8 billion. In the 21st century, basic discovery research is funded primarily by governments and by philanthropic organizations, while late-stage development is funded primarily by pharmaceutical companies or venture capitalists. To be allowed to come to market, drugs must undergo several successful phases of clinical trials, and pass through a new drug approval process, called the New Drug Application in the United States. Discovering drugs that may be a commercial success, or a public health success, involves a complex interaction between investors, industry, academia, patent laws, regulatory exclusivity, marketing, and the need to balance secrecy with communication. Meanwhile, for disorders whose rarity means that no large commercial success or public health effect can be expected, the orphan drug funding process ensures that people who experience those disorders can have some hope of pharmacotherapeutic advances.
Sources: en.wikipedia.org
Legality depends on the country and the intended use. In many places it is sold as a research chemical, but sports and medicine regulations restrict it.
Detection commonly uses liquid chromatography–tandem mass spectrometry. This method can identify the compound in urine or blood at low concentrations.
Typical guidance is −20 °C, dry, and protected from light. Solutions should be aliquoted and limited freeze–thaw cycles should be used.
Its legal status depends on the country and intended use. It is not an approved medicine in major jurisdictions. In sport, it is prohibited by anti-doping rules.